glycoengineering
Acerca de
Esta habilidad analiza e ingenieriza la glicosilación de proteínas al escanear secuencias en busca de sitios de N-glicosilación y predecir puntos calientes de O-glicosilación. Proporciona acceso a herramientas curadas como NetOGlyc y GlycoWorkbench para tareas prácticas. Úsela para la ingeniería de glicoproteínas, la optimización de anticuerpos terapéuticos y el diseño de vacunas.
Instalación rápida
Claude Code
Recomendadonpx skills add K-Dense-AI/claude-scientific-skills -a claude-code/plugin add https://github.com/K-Dense-AI/claude-scientific-skillsgit clone https://github.com/K-Dense-AI/claude-scientific-skills.git ~/.claude/skills/glycoengineeringCopia y pega este comando en Claude Code para instalar esta habilidad
Documentación
Glycoengineering
Overview
Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.
Two major glycosylation types:
- N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi
- O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation
When to Use This Skill
Use this skill when:
- Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity
- Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity
- Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes
- Biosimilar characterization: Compare glycan patterns between reference and biosimilar
- Drug target analysis: Does glycosylation affect target engagement for a receptor?
- Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations
N-Glycosylation Sequon Analysis
Scanning for N-Glycosylation Sites
N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.
import re
from typing import List, Tuple
def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
"""
Scan a protein sequence for canonical N-linked glycosylation sequons.
Motif: N-X-[S/T], where X ≠ Proline.
Args:
sequence: Single-letter amino acid sequence
Returns:
List of dicts with position (1-based), motif, and context
"""
seq = sequence.upper()
results = []
i = 0
while i <= len(seq) - 3:
triplet = seq[i:i+3]
if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
context = seq[max(0, i-3):i+6] # ±3 residue context
results.append({
'position': i + 1, # 1-based
'motif': triplet,
'context': context,
'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
})
i += 3
else:
i += 1
return results
def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
"""Generate a research log summary of N-glycosylation sites."""
sequons = find_n_glycosylation_sequons(sequence)
lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
lines.append(f"Sequence length: {len(sequence)}")
lines.append(f"Total N-glycosylation sequons: {len(sequons)}")
if sequons:
lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
lines.append(f"\nSite details:")
for s in sequons:
lines.append(f" Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
else:
lines.append("No canonical N-glycosylation sequons detected.")
return "\n".join(lines)
# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))
Mutating N-Glycosylation Sites
def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
"""
Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).
Args:
sequence: Protein sequence
position: 1-based position of the Asn to mutate
replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)
Returns:
Mutated sequence
"""
seq = list(sequence.upper())
idx = position - 1
assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
seq[idx] = replacement.upper()
return ''.join(seq)
def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
"""
Introduce an N-glycosylation site by mutating a residue to Asn,
and ensuring X ≠ Pro and +2 = S/T.
Args:
position: 1-based position to introduce Asn
flanking_context: 'S' or 'T' at position+2 (if modification needed)
"""
seq = list(sequence.upper())
idx = position - 1
# Mutate to Asn
seq[idx] = 'N'
# Ensure X+1 != Pro (mutate to Ala if needed)
if idx + 1 < len(seq) and seq[idx + 1] == 'P':
seq[idx + 1] = 'A'
# Ensure X+2 = S or T
if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
seq[idx + 2] = flanking_context
return ''.join(seq)
O-Glycosylation Analysis
Heuristic O-Glycosylation Hotspot Prediction
def predict_o_glycosylation_hotspots(
sequence: str,
window: int = 7,
min_st_fraction: float = 0.4,
disallow_proline_next: bool = True
) -> List[dict]:
"""
Heuristic O-glycosylation hotspot scoring based on local S/T density.
Not a substitute for NetOGlyc; use as fast baseline.
Rules:
- O-GalNAc glycosylation clusters on Ser/Thr-rich segments
- Flag Ser/Thr residues in windows enriched for S/T
- Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)
Args:
window: Odd window size for local S/T density
min_st_fraction: Minimum fraction of S/T in window to flag site
"""
if window % 2 == 0:
window = 7
seq = sequence.upper()
half = window // 2
candidates = []
for i, aa in enumerate(seq):
if aa not in ('S', 'T'):
continue
if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
continue
start = max(0, i - half)
end = min(len(seq), i + half + 1)
segment = seq[start:end]
st_count = sum(1 for c in segment if c in ('S', 'T'))
frac = st_count / len(segment)
if frac >= min_st_fraction:
candidates.append({
'position': i + 1,
'residue': aa,
'st_fraction': round(frac, 3),
'window': f"{start+1}-{end}",
'segment': segment
})
return candidates
External Glycoengineering Tools
1. NetOGlyc 4.0 (O-glycosylation prediction)
Web service for high-accuracy O-GalNAc site prediction:
- URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
- Input: FASTA protein sequence
- Output: Per-residue O-glycosylation probability scores
- Method: Neural network trained on experimentally verified O-GalNAc sites
import requests
def submit_netoglycv4(fasta_sequence: str) -> str:
"""
Submit sequence to NetOGlyc 4.0 web service.
Returns the job URL for result retrieval.
Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
"""
url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
# NetOGlyc submission (parameters may vary with web service version)
# Recommend using the web interface directly for most use cases
print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
return url
# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/
2. GlycoShield-MD (Glycan Shielding Analysis)
GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:
- URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/
- Use: Map glycan shielding on protein surface over MD trajectory
- Output: Per-residue shielding fraction, visualization
# Installation
pip install glycoshield
# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
--topology glycoprotein.pdb \
--trajectory glycoprotein.xtc \
--glycan_resnames BGLCNA FUC \
--output shielding_analysis/
3. GlycoWorkbench (Glycan Structure Drawing/Analysis)
- URL: https://www.eurocarbdb.org/project/glycoworkbench
- Use: Draw glycan structures, calculate masses, annotate MS spectra
- Format: GlycoCT, IUPAC condensed glycan notation
4. GlyConnect (Glycan-Protein Database)
- URL: https://glyconnect.expasy.org/
- Use: Find experimentally verified glycoproteins and glycosylation sites
- Query: By protein (UniProt ID), glycan structure, or tissue
import requests
def query_glyconnect(uniprot_id: str) -> dict:
"""Query GlyConnect for glycosylation data for a protein."""
url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
response = requests.get(url, headers={"Accept": "application/json"})
if response.status_code == 200:
return response.json()
return {}
# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")
5. UniCarbKB (Glycan Structure Database)
- URL: https://unicarbkb.org/
- Use: Browse glycan structures, search by mass or composition
- Format: GlycoCT or IUPAC notation
Key Glycoengineering Strategies
For Therapeutic Antibodies
| Goal | Strategy | Notes |
|---|---|---|
| Enhance ADCC | Defucosylation at Fc Asn297 | Afucosylated IgG1 has ~50× better FcγRIIIa binding |
| Reduce immunogenicity | Remove non-human glycans | Eliminate α-Gal, NGNA epitopes |
| Improve PK half-life | Sialylation | Sialylated glycans extend half-life |
| Reduce inflammation | Hypersialylation | IVIG anti-inflammatory mechanism |
| Create glycan shield | Add N-glycosites to surface | Masks vulnerable epitopes (vaccine design) |
Common Mutations Used
| Mutation | Effect |
|---|---|
| N297A/Q (IgG1) | Removes Fc glycosylation (aglycosyl) |
| N297D (IgG1) | Removes Fc glycosylation |
| S298A/E333A/K334A | Increases FcγRIIIa binding |
| F243L (IgG1) | Increases defucosylation |
| T299A | Removes Fc glycosylation |
Glycan Notation
IUPAC Condensed Notation (Monosaccharide abbreviations)
| Symbol | Full Name | Type |
|---|---|---|
| Glc | Glucose | Hexose |
| GlcNAc | N-Acetylglucosamine | HexNAc |
| Man | Mannose | Hexose |
| Gal | Galactose | Hexose |
| Fuc | Fucose | Deoxyhexose |
| Neu5Ac | N-Acetylneuraminic acid (Sialic acid) | Sialic acid |
| GalNAc | N-Acetylgalactosamine | HexNAc |
Complex N-Glycan Structure
Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)
Best Practices
- Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
- Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
- Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
- For antibodies: Fc N297 glycan is critical — always characterize this site first
- Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data
Additional Resources
- GlyTouCan (glycan structure repository): https://glytoucan.org/
- GlyConnect: https://glyconnect.expasy.org/
- CFG Functional Glycomics: http://www.functionalglycomics.org/
- DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/
- GlycoWorkbench: https://glycoworkbench.software.informer.com/
- Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035
- Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661
Repositorio GitHub
Frequently asked questions
What is the glycoengineering skill?
glycoengineering is a Claude Skill by K-Dense-AI. Skills package instructions and resources that Claude loads on demand, so Claude can perform glycoengineering-related tasks without extra prompting.
How do I install glycoengineering?
Use the install commands on this page: add glycoengineering to Claude Code as a plugin, or clone its repository into your skills directory, then restart Claude so it picks up the skill.
What category does glycoengineering belong to?
glycoengineering is in the Design category, tagged design.
Is glycoengineering free to use?
Yes. glycoengineering is listed on AIMCP and free to install. It runs inside Claude, so no separate service account is required to use the skill itself.
Habilidades relacionadas
Utilice la habilidad executing-plans cuando tenga un plan de implementación completo para ejecutar en lotes controlados con puntos de revisión. Esta habilidad carga y revisa críticamente el plan, luego ejecuta tareas en pequeños lotes (por defecto 3 tareas) mientras reporta el progreso entre cada lote para la revisión del arquitecto. Esto asegura una implementación sistemática con puntos de control de calidad integrados.
Esta habilidad despacha un subagente revisor de código para analizar los cambios en el código frente a los requisitos antes de proceder. Debe usarse después de completar tareas, implementar funciones principales o antes de fusionar con la rama principal. La revisión ayuda a detectar problemas de forma temprana al comparar la implementación actual con el plan original.
Esta habilidad proporciona una guía integral para que los desarrolladores conecten servidores MCP a Claude Code mediante transportes HTTP, stdio o SSE. Cubre la instalación, configuración, autenticación y seguridad para integrar servicios externos como GitHub, Notion y APIs personalizadas. Úsala al configurar integraciones MCP, al configurar herramientas externas o al trabajar con el Protocolo de Contexto del Modelo de Claude.
Esta habilidad ayuda a los desarrolladores a elegir entre las interfaces web y CLI de Claude Code mediante el análisis de tareas, y luego permite la teletransportación fluida de sesiones entre estos entornos. Optimiza el flujo de trabajo gestionando el estado y el contexto de la sesión al cambiar entre web, CLI o móvil. Úsala para proyectos complejos que requieren diferentes herramientas en varias etapas.
