rowan
Acerca de
Rowan ofrece una API en Python para modelado molecular basado en la nube y flujos de trabajo de química medicinal, incluyendo predicción de pKa, acoplamiento molecular, generación de conformeros y dinámica molecular. Es ideal para cribado programático por lotes y tuberías de múltiples pasos, eliminando la necesidad de gestionar infraestructura local de HPC/GPU. Los desarrolladores pueden utilizarlo para tareas de descubrimiento de fármacos como co-plegamiento proteína-ligando, cálculos de descriptores y cribado de análogos.
Instalación rápida
Claude Code
Recomendadonpx skills add K-Dense-AI/claude-scientific-skills -a claude-code/plugin add https://github.com/K-Dense-AI/claude-scientific-skillsgit clone https://github.com/K-Dense-AI/claude-scientific-skills.git ~/.claude/skills/rowanCopia y pega este comando en Claude Code para instalar esta habilidad
Documentación
Rowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows
Overview
Rowan is a cloud-native workflow platform for molecular simulation, medicinal chemistry, and structure-based design. Its Python API exposes a unified interface for small-molecule modeling, property prediction, docking, molecular dynamics, and AI structure workflows.
Use Rowan when you want to run medicinal-chemistry or molecular-design workflows programmatically without maintaining local HPC infrastructure, GPU provisioning, or a collection of separate modeling tools. Rowan handles all infrastructure, result management, and computation scaling.
When to use Rowan
Rowan is a good fit for:
- Quantum chemistry, semiempirical methods, or neural network potentials
- Batch property prediction (pKa, descriptors, permeability, solubility)
- Conformer and tautomer ensemble generation
- Docking workflows (single-ligand, analogue series, pose refinement)
- Protein-ligand cofolding and MSA generation
- Multi-step chemistry pipelines (e.g., tautomer search → docking → pose analysis)
- Batch medicinal-chemistry campaigns where you need consistent, scalable infrastructure
Rowan is not the right fit for:
- Simple molecular I/O (use RDKit directly)
- Post-HF ab initio quantum chemistry or relativistic calculations
Access and pricing model
Rowan uses a credit-based usage model. All users, including free-tier users, can create API keys and use the Python API.
Free-tier access
- Access to all Rowan core workflows
- 20 credits per week
- 500 signup credits
Pricing and credit consumption
Credits are consumed according to compute type:
- CPU: 1 credit per minute
- GPU: 3 credits per minute
- H100/H200 GPU: 7 credits per minute
Purchased credits are priced per credit and remain valid for up to one year from purchase.
Typical cost estimates
| Workflow | Typical Runtime | Estimated Credits | Notes |
|---|---|---|---|
| Descriptors | <1 min | 0.5–2 | Lightweight, good for triage |
| pKa (single transition) | 2–5 min | 2–5 | Depends on molecule size |
| MacropKa (pH 0–14) | 5–15 min | 5–15 | Broader sampling, higher cost |
| Conformer search | 3–10 min | 3–10 | Ensemble quality matters |
| Tautomer search | 2–5 min | 2–5 | Heterocyclic systems |
| Docking (single ligand) | 5–20 min | 5–20 | Depends on pocket size, refinement |
| Analogue docking series (10–50 ligands) | 30–120 min | 30–100+ | Shared reference frame |
| MSA generation | 5–30 min | 5–30 | Sequence length dependent |
| Protein-ligand cofolding | 15–60 min | 20–50+ | AI structure prediction, GPU-heavy |
Quick start
uv pip install rowan-python
import rowan
rowan.api_key = "your_api_key_here" # or set ROWAN_API_KEY env var
# Submit a descriptors workflow — completes in under a minute
wf = rowan.submit_descriptors_workflow("CC(=O)Oc1ccccc1C(=O)O", name="aspirin")
result = wf.result()
print(result.descriptors['MW']) # 180.16
print(result.descriptors['SLogP']) # 1.19
print(result.descriptors['TPSA']) # 59.44
If that prints without error, you're set up correctly.
Installation
uv pip install rowan-python
# or: pip install rowan-python
User and webhook management
Authentication
Set an API key via environment variable (recommended):
export ROWAN_API_KEY="your_api_key_here"
Or set directly in Python:
import rowan
rowan.api_key = "your_api_key_here"
Verify authentication:
import rowan
user = rowan.whoami() # Returns user info if authenticated
print(f"User: {user.email}")
print(f"Credits available: {user.credits_available_string}")
Webhook secret management
For webhook signature verification, manage secrets through your user account:
import rowan
# Get your current webhook secret (returns None if none exists)
secret = rowan.get_webhook_secret()
if secret is None:
secret = rowan.create_webhook_secret()
print(f"Secret key: {secret.secret}")
# Rotate your secret (invalidates old, creates new)
# Use this periodically for security
new_secret = rowan.rotate_webhook_secret()
print(f"New secret created (old secret disabled): {new_secret.secret}")
# Verify incoming webhook signatures
is_valid = rowan.verify_webhook_secret(
request_body=b"...", # Raw request body (bytes)
signature="X-Rowan-Signature", # From request header
secret=secret.secret
)
Molecule input formats
Rowan accepts molecules in the following formats:
- SMILES (preferred):
"CCO","c1ccccc1O" - SMARTS patterns (for some workflows): subset of SMARTS for substructure matching
- InChI (if supported in your API version):
"InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"
The API will validate input and raise a rowan.ValidationError if a molecule cannot be parsed. Always use canonicalized SMILES for reproducibility.
Tip: Use RDKit to validate SMILES before submission:
from rdkit import Chem
smiles = "CCO"
mol = Chem.MolFromSmiles(smiles)
if mol is None:
raise ValueError(f"Invalid SMILES: {smiles}")
Core usage pattern
Most Rowan tasks follow the same three-step pattern:
- Submit a workflow
- Wait for completion (with optional streaming)
- Retrieve typed results with convenience properties
import rowan
# 1. Submit — use the specific workflow function (not the generic submit_workflow)
workflow = rowan.submit_descriptors_workflow(
"CC(=O)Oc1ccccc1C(=O)O",
name="aspirin descriptors",
)
# 2. & 3. Wait and retrieve
result = workflow.result() # Blocks until done (default: wait=True, poll_interval=5)
print(result.data) # Raw dict
print(result.descriptors['MW']) # 180.16 — use result.descriptors dict, not result.molecular_weight
For long-running workflows, use streaming:
for partial in workflow.stream_result(poll_interval=5):
print(f"Progress: {partial.complete}%")
print(partial.data)
result() vs. stream_result()
| Pattern | Use When | Duration |
|---|---|---|
result() | You can wait for the full result | <5 min typical |
stream_result() | You want progress feedback or need early partial results | >5 min, or interactive use |
Guideline: Use result() for descriptors, pKa. Use stream_result() for conformer search, docking, cofolding.
Working with results
Rowan's API includes typed workflow result objects with convenience properties.
Using typed properties and .data
Results have two access patterns:
- Convenience properties (recommended first):
result.descriptors,result.best_pose,result.conformer_energies - Raw fallback:
result.data— raw dictionary from the API
Example:
result = rowan.submit_descriptors_workflow(
"CCO",
name="ethanol",
).result()
# Convenience property (returns dict of all descriptors):
print(result.descriptors['MW']) # 46.042
print(result.descriptors['SLogP']) # -0.001
print(result.descriptors['TPSA']) # 57.96
# Raw data fallback (descriptors are nested under 'descriptors' key):
print(result.data['descriptors'])
# {'MW': 46.042, 'SLogP': -0.001, 'TPSA': 57.96, 'nHBDon': 1.0, 'nHBAcc': 1.0, ...}
Note: DescriptorsResult does not have a molecular_weight property. Descriptor keys use short names (MW, SLogP, nHBDon) not verbose names.
Cache invalidation
Some result properties are lazily loaded (e.g., conformer geometries, protein structures). To refresh:
result.clear_cache()
new_structures = result.conformer_molecules # Refetched
Projects, folders, and organization
For nontrivial campaigns, use projects and folders to keep work organized.
Projects
import rowan
# Create a project
project = rowan.create_project(name="CDK2 lead optimization")
rowan.set_project("CDK2 lead optimization")
# All subsequent workflows go into this project
wf = rowan.submit_descriptors_workflow("CCO", name="test compound")
# Retrieve later
project = rowan.retrieve_project("CDK2 lead optimization")
workflows = rowan.list_workflows(project=project, size=50)
Folders
# Create a hierarchical folder structure
folder = rowan.create_folder(name="docking/batch_1/screening")
wf = rowan.submit_docking_workflow(
# ... docking params ...
folder=folder,
name="compound_001",
)
# List workflows in a folder
results = rowan.list_workflows(folder=folder)
Workflow decision trees
pKa vs. MacropKa
Use microscopic pKa when:
- You need the pKa of a single ionizable group
- You're interested in acid–base transitions and protonation thermodynamics
- The molecule has one or two ionizable sites
- Speed is critical (faster, fewer credits)
Use macropKa when:
- You need pH-dependent behavior across a physiologically relevant range (e.g., 0–14)
- You want aggregated charge and protonation-state populations across pH
- The molecule has multiple ionizable groups with coupled protonation
- You need downstream properties like aqueous solubility at different pH
Example decision:
Phenol (pKa ~10): Use microscopic pKa
Amine (pKa ~9–10): Use microscopic pKa
Multi-ionizable drug (N, O, acidic group): Use macropKa
ADME assessment across GI pH: Use macropKa
Conformer search vs. tautomer search
Use conformer search when:
- A single tautomeric form is known
- You need a diverse 3D ensemble for docking, MD, or SAR analysis
- Rotatable bonds dominate the chemical space
Use tautomer search when:
- Tautomeric equilibrium is uncertain (e.g., heterocycles, keto–enol systems)
- You need to model all relevant protonation isomers
- Downstream calculations (docking, pKa) depend on tautomeric form
Combined workflow:
# Step 1: Find best tautomer
taut_wf = rowan.submit_tautomer_search_workflow(
initial_molecule="O=c1[nH]ccnc1",
name="imidazole tautomers",
)
best_taut = taut_wf.result().best_tautomer
# Step 2: Generate conformers from best tautomer
conf_wf = rowan.submit_conformer_search_workflow(
initial_molecule=best_taut,
name="imidazole conformers",
)
Docking vs. analogue docking vs. cofolding
| Workflow | Use When | Input | Output |
|---|---|---|---|
| Docking | Single ligand, known pocket | Protein + SMILES + pocket coords | Pose, score, dG |
| Analogue docking | 5–100+ related compounds | Protein + SMILES list + reference ligand | All poses, reference-aligned |
| Protein-ligand cofolding | Sequence + ligand, no crystal structure | Protein sequence + SMILES | ML-predicted bound complex |
Common workflow categories
1. Descriptors
A lightweight entry point for batch triage, SAR, or exploratory scripts.
wf = rowan.submit_descriptors_workflow(
"CC(=O)Oc1ccccc1C(=O)O", # positional arg, accepts SMILES string
name="aspirin descriptors",
)
result = wf.result()
print(result.descriptors['MW']) # 180.16
print(result.descriptors['SLogP']) # 1.19
print(result.descriptors['TPSA']) # 59.44
print(result.data['descriptors'])
# {'MW': 180.16, 'SLogP': 1.19, 'TPSA': 59.44, 'nHBDon': 1.0, 'nHBAcc': 4.0, ...}
Common descriptor keys:
| Key | Description | Typical drug range |
|---|---|---|
MW | Molecular weight (Da) | <500 (Lipinski) |
SLogP | Calculated LogP (lipophilicity) | -2 to +5 |
TPSA | Topological polar surface area (Ų) | <140 for oral bioavailability |
nHBDon | H-bond donor count | ≤5 (Lipinski) |
nHBAcc | H-bond acceptor count | ≤10 (Lipinski) |
nRot | Rotatable bond count | <10 for oral drugs |
nRing | Ring count | — |
nHeavyAtom | Heavy atom count | — |
FilterItLogS | Estimated aqueous solubility (LogS) | >-4 preferred |
Lipinski | Lipinski Ro5 pass (1.0) or fail (0.0) | — |
The result contains hundreds of additional molecular descriptors (BCUT, GETAWAY, WHIM, etc.); access any via result.descriptors['key'].
2. Microscopic pKa
For protonation-state energetics and acid/base behavior of a specific structure.
Two methods are available:
| Method | Input | Speed | Covers | Use when |
|---|---|---|---|---|
chemprop_nevolianis2025 | SMILES string | Fast | Deprotonation only (anionic conjugate bases) | Acidic groups only; quick screening |
starling | SMILES string | Fast | Acid + base (full protonation/deprotonation) | Most drug-like molecules; preferred SMILES method |
aimnet2_wagen2024 (default) | 3D molecule object | Slower, higher accuracy | Acid + base | You already have a 3D structure (e.g. from conformer search) |
# Fast path: SMILES input with full acid+base coverage (use starling method when available)
wf = rowan.submit_pka_workflow(
initial_molecule="c1ccccc1O", # phenol SMILES; param is initial_molecule, not initial_smiles
method="starling", # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only
name="phenol pKa",
)
result = wf.result()
print(result.strongest_acid) # 9.81 (pKa of the most acidic site)
print(result.conjugate_bases) # list of {pka, smiles, atom_index, ...} per deprotonatable site
3. MacropKa
For pH-dependent protonation behavior across a range.
wf = rowan.submit_macropka_workflow(
initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32", # imidazole
min_pH=0,
max_pH=14,
min_charge=-2, # default
max_charge=2, # default
compute_aqueous_solubility=True, # default
name="imidazole macropKa",
)
result = wf.result()
print(result.pka_values) # list of pKa values
print(result.logd_by_ph) # dict of {pH: logD}
print(result.aqueous_solubility_by_ph) # dict of {pH: solubility}
print(result.isoelectric_point) # isoelectric point
print(result.data)
# {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...}
4. Conformer search
For 3D ensemble generation when ensemble quality matters.
wf = rowan.submit_conformer_search_workflow(
initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12",
num_conformers=50, # Optional: override default
name="conformer search",
)
result = wf.result()
print(result.conformer_energies) # [0.0, 1.2, 2.5, ...]
print(result.conformer_molecules) # List of 3D molecules
print(result.best_conformer) # Lowest-energy conformer
5. Tautomer search
For heterocycles and systems where tautomer state affects downstream modeling.
wf = rowan.submit_tautomer_search_workflow(
initial_molecule="O=c1[nH]ccnc1", # or keto tautomer
name="imidazolone tautomers",
)
result = wf.result()
print(result.best_tautomer) # Most stable SMILES string
print(result.tautomers) # List of tautomeric SMILES
print(result.molecules) # List of molecule objects
6. Docking
For protein-ligand docking with optional pose refinement and conformer generation.
# Upload protein once, reuse in multiple workflows
protein = rowan.upload_protein(
name="CDK2",
file_path="cdk2.pdb",
)
# Define binding pocket
pocket = {
"center": [10.5, 24.2, 31.8],
"size": [18.0, 18.0, 18.0],
}
# Submit docking
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule="CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1",
do_pose_refinement=True,
do_conformer_search=True,
name="lead docking",
)
result = wf.result()
print(result.scores) # Docking scores (kcal/mol)
print(result.best_pose) # Mol object with 3D coordinates
print(result.data) # Raw result dict
Protein preparation tips:
- PDB files should be reasonably clean (remove water/heteroatoms unless intended)
- Use the same protein object across a docking series for consistency
- If you have a PDB ID, use
rowan.create_protein_from_pdb_id()instead
7. Analogue docking
For placing a compound series into a shared binding context.
# Analogue series (e.g., SAR campaign)
analogues = [
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # reference
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # chloro
"CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1", # methoxy
"CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro
]
wf = rowan.submit_analogue_docking_workflow(
analogues=analogues,
initial_molecule=analogues[0], # Reference ligand
protein=protein,
pocket=pocket,
name="SAR series docking",
)
result = wf.result()
print(result.analogue_scores) # List of scores for each analogue
print(result.best_poses) # List of poses
8. MSA generation
For multiple-sequence alignment (useful for downstream cofolding).
wf = rowan.submit_msa_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
output_formats=["colabfold", "chai", "boltz"],
name="target MSA",
)
result = wf.result()
result.download_files() # Downloads alignments to disk
9. Protein-ligand cofolding
For AI-based bound-complex prediction when no crystal structure is available.
wf = rowan.submit_protein_cofolding_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
initial_smiles_list=[
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"
],
name="protein-ligand cofolding",
)
result = wf.result()
print(result.predictions) # List of predicted structures
print(result.messages) # Model metadata/warnings
predicted_structure = result.get_predicted_structure()
predicted_structure.write("predicted_complex.pdb")
All supported workflow types
All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization.
Core molecular modeling workflows
| Workflow | Function | When to use |
|---|---|---|
| Descriptors | submit_descriptors_workflow | First-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter |
| pKa | submit_pka_workflow | Single ionizable group; need protonation thermodynamics |
| MacropKa | submit_macropka_workflow | Multi-ionizable drugs; pH-dependent charge/LogD/solubility |
| Conformer Search | submit_conformer_search_workflow | 3D ensemble for docking, MD, or SAR; known tautomer |
| Tautomer Search | submit_tautomer_search_workflow | Heterocycles, keto–enol; uncertain tautomeric form |
| Solubility | submit_solubility_workflow | Aqueous or solvent-specific solubility prediction |
| Membrane Permeability | submit_membrane_permeability_workflow | Caco-2, PAMPA, BBB, plasma permeability |
| ADMET | submit_admet_workflow | Broad drug-likeness and ADMET property sweep |
Structure-based design workflows
| Workflow | Function | When to use |
|---|---|---|
| Docking | submit_docking_workflow | Single ligand, known binding pocket |
| Analogue Docking | submit_analogue_docking_workflow | SAR series (5–100+ compounds) in a shared pocket |
| Batch Docking | submit_batch_docking_workflow | Fast library screening; large compound sets |
| Protein MD | submit_protein_md_workflow | Long-timescale dynamics; conformational sampling |
| Pose Analysis MD | submit_pose_analysis_md_workflow | MD refinement of a docking pose |
| Protein Cofolding | submit_protein_cofolding_workflow | No crystal structure; AI-predicted bound complex |
| Protein Binder Design | submit_protein_binder_design_workflow | De novo binder generation against a protein target |
Advanced computational chemistry
| Workflow | Function | When to use |
|---|---|---|
| Basic Calculation | submit_basic_calculation_workflow | QM/ML geometry optimization or single-point energy |
| Electronic Properties | submit_electronic_properties_workflow | Dipole, partial charges, HOMO-LUMO, ESP |
| BDE | submit_bde_workflow | Bond dissociation energies; metabolic soft-spot prediction |
| Redox Potential | submit_redox_potential_workflow | Oxidation/reduction potentials |
| Spin States | submit_spin_states_workflow | Spin-state energy ordering for organometallics/radicals |
| Strain | submit_strain_workflow | Conformational strain relative to global minimum |
| Scan | submit_scan_workflow | PES scans; torsion profiles |
| Multistage Optimization | submit_multistage_opt_workflow | Progressive optimization across levels of theory |
Reaction chemistry
| Workflow | Function | When to use |
|---|---|---|
| Double-Ended TS Search | submit_double_ended_ts_search_workflow | Transition state between two known structures |
| IRC | submit_irc_workflow | Confirm TS connectivity; intrinsic reaction coordinate |
Advanced properties
| Workflow | Function | When to use |
|---|---|---|
| NMR | submit_nmr_workflow | Predicted 1H/13C chemical shifts for structure verification |
| Ion Mobility | submit_ion_mobility_workflow | Collision cross-section (CCS) for MS method development |
| Hydrogen Bond Strength | submit_hydrogen_bond_basicity_workflow | H-bond donor/acceptor strength for formulation/solubility |
| Fukui | submit_fukui_workflow | Site reactivity indices for electrophilic/nucleophilic attack |
| Interaction Energy Decomposition | submit_interaction_energy_decomposition_workflow | Fragment-level interaction analysis |
Binding free energy
| Workflow | Function | When to use |
|---|---|---|
| RBFE/FEP | submit_relative_binding_free_energy_perturbation_workflow | Relative ΔΔG for congeneric series |
| RBFE Graph | submit_rbfe_graph_workflow | Build and optimize an RBFE perturbation network |
Sequence and structural biology
| Workflow | Function | When to use |
|---|---|---|
| MSA | submit_msa_workflow | Multiple sequence alignment for cofolding (ColabFold, Chai, Boltz) |
| Solvent-Dependent Conformers | submit_solvent_dependent_conformers_workflow | Solvation-aware conformer ensembles |
Batch submission and retrieval
For libraries or analogue series, submit in a loop using the specific workflow function. The generic rowan.batch_submit_workflow() and rowan.submit_workflow() functions currently return 422 errors from the API — use the named functions (submit_descriptors_workflow, submit_pka_workflow, etc.) instead.
Submit a batch
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
names = ["ethanol", "acetic acid", "phenol"]
workflows = [
rowan.submit_descriptors_workflow(smi, name=name)
for smi, name in zip(smileses, names)
]
print(f"Submitted {len(workflows)} workflows")
Poll batch status
statuses = rowan.batch_poll_status([wf.uuid for wf in workflows])
# Returns aggregate counts — not per-UUID:
# {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...}
if statuses["complete"] == statuses["total"]:
print("All workflows done")
elif statuses["failed"] > 0:
print(f"{statuses['failed']} workflows failed")
Retrieve and collect results
results = []
for wf in workflows:
try:
result = wf.result()
results.append(result.data)
except rowan.WorkflowError as e:
print(f"Workflow {wf.uuid} failed: {e}")
# Optionally aggregate into DataFrame
import pandas as pd
df = pd.DataFrame(results)
Non-blocking / fire-and-check pattern
For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process.
Session 1 — submit and save UUIDs:
import rowan, json
rowan.api_key = "..."
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
workflows = [
rowan.submit_descriptors_workflow(smi, name=f"compound_{i}")
for i, smi in enumerate(smileses)
]
# Save UUIDs to disk (or a database)
uuids = [wf.uuid for wf in workflows]
with open("workflow_uuids.json", "w") as f:
json.dump(uuids, f)
print("Submitted. Check back later.")
Session 2 — check status and collect results when ready:
import rowan, json
rowan.api_key = "..."
with open("workflow_uuids.json") as f:
uuids = json.load(f)
results = []
for uuid in uuids:
wf = rowan.retrieve_workflow(uuid)
if wf.done():
result = wf.result(wait=False)
results.append({"uuid": uuid, "data": result.data})
else:
print(f"{uuid}: still running ({wf.status})")
print(f"Collected {len(results)} completed results")
Webhooks and asynchronous workflows
For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete.
Setting up webhooks
Every workflow submission function accepts a webhook_url parameter:
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule="CCO",
webhook_url="https://myserver.com/rowan_callback",
name="docking with webhook",
)
print(f"Workflow submitted. Result will be POSTed to webhook when complete.")
Webhook URLs can be passed to any specific workflow function (submit_docking_workflow(), submit_pka_workflow(), submit_descriptors_workflow(), etc.).
Webhook authentication with secrets
Rowan supports webhook signature verification to ensure requests are authentic. You'll need to:
- Create or retrieve a webhook secret:
import rowan
# Create a new webhook secret
secret = rowan.create_webhook_secret()
print(f"Your webhook secret: {secret.secret}")
# Or retrieve an existing secret
secret = rowan.get_webhook_secret()
# Rotate your secret (invalidates old one, creates new)
new_secret = rowan.rotate_webhook_secret()
- Verify incoming webhook requests:
import rowan
import hmac
import json
def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool:
"""Verify the HMAC-SHA256 signature of a webhook request."""
return rowan.verify_webhook_secret(request_body, signature, secret)
Webhook payload and signature
When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header:
X-Rowan-Signature: <HMAC-SHA256 signature>
The request body contains the complete workflow result:
{
"workflow_uuid": "wf_12345abc",
"workflow_type": "docking",
"workflow_name": "lead docking",
"status": "COMPLETED_OK",
"created_at": "2025-04-01T12:00:00Z",
"completed_at": "2025-04-01T12:15:30Z",
"data": {
"scores": [-8.2, -8.0, -7.9],
"best_pose": {...},
"metadata": {...}
}
}
Example webhook handler with signature verification (FastAPI)
from fastapi import FastAPI, Request, HTTPException
import rowan
import json
app = FastAPI()
_ws = rowan.get_webhook_secret() or rowan.create_webhook_secret()
webhook_secret = _ws.secret
@app.post("/rowan_callback")
async def handle_rowan_webhook(request: Request):
# Get request body and signature
body = await request.body()
signature = request.headers.get("X-Rowan-Signature")
if not signature:
raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header")
# Verify signature
if not rowan.verify_webhook_secret(body, signature, webhook_secret):
raise HTTPException(status_code=401, detail="Invalid webhook signature")
# Parse and process
payload = json.loads(body)
wf_uuid = payload["workflow_uuid"]
status = payload["status"]
if status == "COMPLETED_OK":
print(f"Workflow {wf_uuid} succeeded!")
result_data = payload["data"]
# Process result, update database, trigger next workflow, etc.
elif status == "FAILED":
print(f"Workflow {wf_uuid} failed!")
# Handle failure
# Respond quickly to prevent retries
return {"status": "received"}
Webhook best practices
- Always verify signatures using
rowan.verify_webhook_secret()to ensure requests are from Rowan - Respond quickly (< 5 seconds); offload heavy processing to async tasks or background jobs
- Implement idempotency: workflows may retry; handle duplicate payloads gracefully using
workflow_uuid - Log all events for debugging and audit trails
- Use for long campaigns: webhooks shine with 50+ workflows; for small jobs, polling with
result()is simpler - Rotate secrets regularly using
rowan.rotate_webhook_secret()for security - Return 2xx status to confirm receipt; Rowan may retry on 5xx errors
Protein utilities
Upload proteins
# From local PDB file
protein = rowan.upload_protein(
name="egfr_kinase_domain",
file_path="egfr_kinase.pdb",
)
# From PDB database
protein_from_pdb = rowan.create_protein_from_pdb_id(
name="CDK2 (1M17)",
code="1M17",
)
# Retrieve previously uploaded protein
protein = rowan.retrieve_protein("protein-uuid")
# List all proteins
my_proteins = rowan.list_proteins()
Protein preparation guidance
- File format: PDB, mmCIF (Rowan auto-detects)
- Water molecules: Rowan usually keeps relevant water; remove bulk water beforehand if desired
- Heteroatoms: Cofactors, ions, and bound ligands are usually preserved; remove unwanted heteroatoms before upload
- Multi-chain proteins: Fully supported
- Resolution: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions
- Validation: Rowan validates PDB syntax; severely malformed files may be rejected
End-to-end example: Lead optimization campaign
This example demonstrates a realistic workflow for optimizing a hit compound:
import rowan
import pandas as pd
# 1. Create a project and folder for organization
project = rowan.create_project(name="CDK2 Hit Optimization")
rowan.set_project("CDK2 Hit Optimization")
folder = rowan.create_folder(name="round_1_tautomers_and_pka")
# 2. Load hit compound and analogues
hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" # Known hit
analogues = [
"CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1", # Remove F
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # Cl instead of F
"CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # Propyl instead of ethyl
]
# 3. Determine best tautomers (just in case)
print("Searching tautomeric forms...")
taut_workflows = [
rowan.submit_tautomer_search_workflow(
smi, name=f"analog_{i}", folder=folder,
)
for i, smi in enumerate(analogues)
]
best_tautomers = []
for wf in taut_workflows:
result = wf.result()
best_tautomers.append(result.best_tautomer)
# 4. Predict pKa and basic properties for all analogues
print("Predicting pKa and properties...")
pka_workflows = [
rowan.submit_pka_workflow(
smi, method="chemprop_nevolianis2025", name=f"pka_{i}", folder=folder,
)
for i, smi in enumerate(best_tautomers)
]
descriptor_workflows = [
rowan.submit_descriptors_workflow(smi, name=f"desc_{i}", folder=folder)
for i, smi in enumerate(best_tautomers)
]
# 5. Collect results
pka_results = []
for wf in pka_workflows:
try:
result = wf.result()
pka_results.append({
"compound": wf.name,
"pka": result.strongest_acid, # pKa of the strongest acid site
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"pKa prediction failed for {wf.name}: {e}")
descriptor_results = []
for wf in descriptor_workflows:
try:
result = wf.result()
desc = result.descriptors
descriptor_results.append({
"compound": wf.name,
"mw": desc.get("MW"),
"logp": desc.get("SLogP"),
"hba": desc.get("nHBAcc"),
"hbd": desc.get("nHBDon"),
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"Descriptor calculation failed for {wf.name}: {e}")
# 6. Merge and summarize
df_pka = pd.DataFrame(pka_results)
df_desc = pd.DataFrame(descriptor_results)
df = df_pka.merge(df_desc, on="compound", how="outer")
print("\n=== Preliminary SAR ===")
print(df.to_string())
# 7. Select promising compound for docking
# compound names are "pka_0", "pka_1", etc. — extract index to look up SMILES
top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1])
top_smiles = best_tautomers[top_idx]
print(f"\nProceeding with docking: {top_smiles}")
# 8. Docking campaign
protein = rowan.create_protein_from_pdb_id(name="CDK2_1CKP", code="1CKP")
pocket = {"center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0]}
docking_wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule=top_smiles,
do_pose_refinement=True,
name=f"docking_{top_compound}",
)
dock_result = docking_wf.result()
print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol")
print(f"Best pose saved to: best_pose.pdb")
dock_result.best_pose.write("best_pose.pdb")
Error handling and troubleshooting
Common errors and solutions
import rowan
# Error 1: Invalid SMILES
try:
wf = rowan.submit_descriptors_workflow("CCCC(CC", name="bad smiles") # Invalid
except rowan.ValidationError as e:
print(f"Invalid SMILES: {e}")
# Solution: Use RDKit to validate before submission
from rdkit import Chem
smi = Chem.MolToSmiles(Chem.MolFromSmiles(smi))
# Error 2: API key not set
try:
wf = rowan.submit_descriptors_workflow("CCO")
except rowan.AuthenticationError:
print("API key not found. Set ROWAN_API_KEY env var or call rowan.api_key = '...'")
# Error 3: Insufficient credits
try:
wf = rowan.submit_protein_cofolding_workflow(...)
except rowan.InsufficientCreditsError as e:
print(f"Not enough credits: {e}. Purchase more or reduce job size.")
# Error 4: Workflow failed (bad molecule, etc.)
try:
wf = rowan.submit_docking_workflow(...)
result = wf.result()
except rowan.WorkflowError as e:
print(f"Workflow failed: {e}")
# Check wf.status for details
print(f"Status: {wf.status}")
# Error 5: Workflow not yet done — poll manually
result = wf.result(wait=True, poll_interval=5) # waits and polls every 5s
# Or check status without blocking:
if not wf.done():
print("Workflow still running. Call wf.result() again later.")
Debugging tips
- Check workflow status:
wf.status, checkwf.done(), or callwf.get_status() - Inspect raw result:
result.datainstead of convenience properties - Re-run failed workflow: Save UUIDs and retry with
rowan.retrieve_workflow(uuid) - Validate molecules beforehand: Use RDKit or Chemaxon before batch submission
Recommended usage patterns
- Prefer Rowan-native workflows over low-level assembly when they exist
- Use projects and folders for any nontrivial campaign (>5 workflows)
- Use
result()to block until complete (default:wait=True, poll_interval=5) - Use typed result properties first, fall back to
.datafor unmapped fields - Use batch submission for compound libraries or analogue series
- Chain workflows for multi-step chemistry campaigns:
pKa → macropKa → permeability(ADME assessment)tautomer search → docking → pose-analysis MD(pose refinement)MSA generation → protein-ligand cofolding(AI structure prediction)
- Use webhooks for long-running campaigns (>50 workflows) or asynchronous pipelines
- Use streaming for interactive feedback on large conformer/docking searches
Summary
Use Rowan when your workflow requires cloud execution for molecular-design tasks, especially when you want one unified API and consistent result handling across small-molecule modeling, proteins, docking, ADME prediction, and ML structure generation.
Rowan is a molecular-design workflow platform, not just a remote chemistry engine. It handles infrastructure scaling, result persistence, and multi-step pipeline orchestration so you can focus on science.
Repositorio GitHub
Preguntas frecuentes
¿Qué es el Skill rowan?
rowan es un Skill de Claude creado por K-Dense-AI. Los Skills agrupan instrucciones y recursos que Claude carga cuando los necesita para realizar tareas relacionadas con rowan sin indicaciones adicionales.
¿Cómo instalo rowan?
Usa los comandos de instalación de esta página: añade rowan a Claude Code como plugin o clona su repositorio en tu directorio de skills y reinicia Claude para cargarlo.
¿A qué categoría pertenece rowan?
rowan pertenece a la categoría Meta.
¿Se puede usar rowan gratis?
Sí. rowan aparece en AIMCP y se puede instalar gratis.
Habilidades relacionadas
Esta habilidad proporciona una configuración probada en producción para Content Collections, una herramienta centrada en TypeScript que transforma archivos Markdown/MDX en colecciones de datos con tipado seguro mediante validación Zod. Úsala al construir blogs, sitios de documentación o aplicaciones Vite + React con mucho contenido para garantizar seguridad de tipos y validación automática de contenido. Abarca todo, desde la configuración del plugin de Vite y compilación MDX hasta la optimización de despliegue y validación de esquemas.
Esta habilidad permite a los desarrolladores crear aplicaciones con la plataforma de mercados de predicción Polymarket, incluyendo la integración de API para operaciones y datos de mercado. También proporciona transmisión de datos en tiempo real a través de WebSocket para monitorear operaciones en vivo y actividad del mercado. Úsela para implementar estrategias de trading o crear herramientas que procesen actualizaciones de mercado en tiempo real.
Esta habilidad ayuda a los desarrolladores a crear complementos de OpenCode que se conectan a más de 25 tipos de eventos, como comandos, archivos y operaciones LSP. Proporciona la estructura del complemento, las especificaciones de la API de eventos y los patrones de implementación para módulos en JavaScript/TypeScript. Úsala cuando necesites interceptar, monitorear o extender el ciclo de vida del asistente de IA de OpenCode con lógica personalizada basada en eventos.
SGLang es un framework de alto rendimiento para el servicio de LLM que se especializa en generación rápida y estructurada para JSON, expresiones regulares y flujos de trabajo de agentes utilizando su caché de prefijos RadixAttention. Ofrece una inferencia significativamente más rápida, especialmente para tareas con prefijos repetidos, lo que lo hace ideal para salidas complejas y estructuradas, y conversaciones multiturno. Elige SGLang sobre alternativas como vLLM cuando necesites decodificación restringida o estés construyendo aplicaciones con uso extensivo de prefijos compartidos.
